DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and ceh-45

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_490823.1 Gene:ceh-45 / 171689 WormBaseID:WBGene00022837 Length:229 Species:Caenorhabditis elegans


Alignment Length:276 Identity:74/276 - (26%)
Similarity:107/276 - (38%) Gaps:92/276 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PSIFAWEIRDRLL---SEQVCNSDNIPSVS---SINRVLRN-LASQKEQQAQQQNESVYEKLRMF 177
            |.:...|..::|:   |..:.:|.:.||.|   ||:.:|.| ||.             ..:|..|
 Worm     5 PFLMTPETMNKLVTPNSASISSSSSSPSTSTSFSIDTLLSNPLAG-------------IPQLHNF 56

  Fly   178 NGQTGG-----------WAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEV 231
            ....|.           |.::|:|.        |..|::..|.              ...|....
 Worm    57 QDPFGAVGAAAAASALPWQFHPANY--------PFFSMLCGPL--------------MPPFMAPY 99

  Fly   232 SHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARE 296
            .|            :|.:|            |:.:|:||.||.||::.||..|..|||||...||
 Worm   100 HH------------QHYAS------------RRKRRHRTIFSEEQLNILETTFSTTHYPDATTRE 140

  Fly   297 RLADKIGLPEARIQVWFSNRRAKWRREEK--MRTQRRSAD--TVDGSGRTS------TANNPSGT 351
            .||.:..|.|.|::|||.|||||.|:::|  .||.:.|.|  ..|.|...:      ...|.||.
 Worm   141 ELAVQCSLKEERVEVWFKNRRAKERKQKKDDSRTSKHSGDDSECDESDEDTRKVKRIKRENSSGK 205

  Fly   352 TASS-----SVATSNN 362
            ..||     |:.||::
 Worm   206 ETSSPESKASLKTSHS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 10/38 (26%)
COG5576 <253..368 CDD:227863 47/125 (38%)
Homeobox 269..322 CDD:395001 29/52 (56%)
ceh-45NP_490823.1 Homeobox 112..166 CDD:365835 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.