DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Vsx2

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_017449515.1 Gene:Vsx2 / 171360 RGDID:621215 Length:380 Species:Rattus norvegicus


Alignment Length:154 Identity:60/154 - (38%)
Similarity:79/154 - (51%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 PSNTTTAHLTLPPA---ASVVTSPANLSG----------QADRDDVQKREL---QFSVEVSHTNS 236
            |.:...|...|.||   :..:..|..|.|          .:|...|..:.|   ...::.|.|.|
  Rat    58 PGHLLAARSVLSPAGVGSMGLLGPGGLPGFYAQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTAS 122

  Fly   237 HDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADK 301
            .||....:|:...|....:|.:   |||.:|:||.|::.|::.|||.|...|||||:|||.||.|
  Rat   123 SDSEDVSSSDRKMSKSALNQTK---KRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMK 184

  Fly   302 IGLPEARIQVWFSNRRAKWRREEK 325
            ..|||.||||||.|||||||:.||
  Rat   185 TELPEDRIQVWFQNRRAKWRKREK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 42/73 (58%)
Homeodomain 267..322 CDD:459649 35/54 (65%)
Vsx2XP_017449515.1 Homeodomain 153..205 CDD:459649 33/51 (65%)
OAR 319..337 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.