DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Lhx8

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_034843.2 Gene:Lhx8 / 16875 MGIID:1096343 Length:367 Species:Mus musculus


Alignment Length:150 Identity:37/150 - (24%)
Similarity:62/150 - (41%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 QRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQR 330
            :|.||||:.:|:..::.:|.:.:.||....::||::.||....|||||.|.||:.::.       
Mouse   247 KRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKH------- 304

  Fly   331 RSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPT 395
                         .:.|.|.:...::|.:|..|.|       .:.|...||.|    |:.....|
Mouse   305 -------------VSPNHSSSAPVTAVPSSRLSPP-------MLEEMAYSAYV----PQDGTMLT 345

  Fly   396 VLGGEANTTHTSSESPPLQP 415
            .|....:......:|.|..|
Mouse   346 ALHSYMDAHQQLLDSSPCYP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 27/101 (27%)
Homeobox 269..322 CDD:395001 20/52 (38%)
Lhx8NP_034843.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..79
LIM1_Lhx7_Lhx8 95..150 CDD:188767
LIM2_Lhx7_Lhx8 157..211 CDD:188769
Homeobox 250..302 CDD:278475 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.