DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and RHOXF1

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_011529583.1 Gene:RHOXF1 / 158800 HGNCID:29993 Length:212 Species:Homo sapiens


Alignment Length:87 Identity:33/87 - (37%)
Similarity:47/87 - (54%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 EDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRR 317
            |:.|.|.|        ||.|:..|::.||..|..|.||||..|..||:.:|:.|.:::|||.|:|
Human   127 ENMQPRTR--------RTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKR 183

  Fly   318 AKWRREEK--MRTQRRSADTVD 337
            |:.||.::  |......||..|
Human   184 ARCRRHQRELMLANELRADPDD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 33/87 (38%)
Homeodomain 267..322 CDD:459649 23/54 (43%)
RHOXF1XP_011529583.1 homeodomain 132..190 CDD:238039 27/65 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.