DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Hoxc5

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:245 Identity:58/245 - (23%)
Similarity:92/245 - (37%) Gaps:73/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LSEQVCN-----SDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNT 191
            :|..|.|     |.|||:.:.  :...|..|..|.||.:......:....|....      |||:
Mouse     1 MSSYVANSFYKQSPNIPAYNM--QTCGNYGSASEVQASRYCYGGLDLSITFPPPA------PSNS 57

  Fly   192 ---------TTAHLTLP--PAASVVTSPANLSG--------------QADRDDVQKRELQFSVEV 231
                     ..||   |  ||.|...:|.:..|              :|.|..:::| .:.|.|:
Mouse    58 LHGVDMAANPRAH---PDRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPALEER-AKSSGEI 118

  Fly   232 SHTNSHDSTSDGNSE-----------------HNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDS 279
            ....:......|.|:                 |.:.|              :|:|||::..|...
Mouse   119 KEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDG--------------KRSRTSYTRYQTLE 169

  Fly   280 LEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQ 329
            |||||....|.....|..:|:.:.|.|.:|::||.|||.||:::.||:::
Mouse   170 LEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 7/25 (28%)
COG5576 <253..368 CDD:227863 25/77 (32%)
Homeobox 269..322 CDD:395001 22/52 (42%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 15/80 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 15/76 (20%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeobox 158..212 CDD:395001 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.