DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and GSC

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_776248.1 Gene:GSC / 145258 HGNCID:4612 Length:257 Species:Homo sapiens


Alignment Length:91 Identity:39/91 - (42%)
Similarity:62/91 - (68%) Gaps:5/91 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAK 319
            :|:..|.||   |:||.|::||:::||..|:.|.||||..||:||.|:.|.|.:::|||.|||||
Human   153 NQLHCRRKR---RHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAK 214

  Fly   320 WRREEKMRTQRRSADTVDGSGRTSTA 345
            |||::  |:....::..:...:||::
Human   215 WRRQK--RSSSEESENAEKWNKTSSS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 39/91 (43%)
Homeodomain 267..322 CDD:459649 30/54 (56%)
GSCNP_776248.1 Homeodomain 161..217 CDD:459649 31/58 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..257 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.