DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Cphx1

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:67/169 - (39%) Gaps:29/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNR 316
            |..|:.|.|...:..:.|..||.:::..|::||....|||...::.||.:.....:.|..||.|:
Mouse    14 DNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEVSVIDNWFQNK 78

  Fly   317 RAKWRREEK-----MRTQRRSADTVDGSGRTSTANNPSGTTASS--SVATSNNSTPGIVNSAINV 374
            ||:...|.|     ||..||..|.:....:.:.....||...||  ||..|      |...:|..
Mouse    79 RARLAPELKSKISAMRRMRRCQDYMRTGHQDTQPPKASGEQYSSCDSVVRS------IGRQSIGT 137

  Fly   375 AERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPL 413
            .|...:|                |.|::...|:...||:
Mouse   138 VEHQGAA----------------GRESSFRPTNFTFPPV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 34/121 (28%)
Homeodomain 267..322 CDD:459649 17/54 (31%)
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.