DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and CPHXL

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001342542.1 Gene:CPHXL / 105371346 HGNCID:51815 Length:405 Species:Homo sapiens


Alignment Length:34 Identity:9/34 - (26%)
Similarity:16/34 - (47%) Gaps:8/34 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 LSSQYRATLIDVVSCGISFQKNRIGNLCKSRKSS 364
            |..:|.|..:..:.|    |:    |:||..::|
Human    77 LEKEYEAKRLTKLKC----QE----NVCKEIQAS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 9/34 (26%)
Homeodomain 267..322 CDD:459649
CPHXLNP_001342542.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
HOX 28..82 CDD:197696 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.