DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and vsx2

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_004917101.1 Gene:vsx2 / 100493176 XenbaseID:XB-GENE-853775 Length:377 Species:Xenopus tropicalis


Alignment Length:151 Identity:57/151 - (37%)
Similarity:70/151 - (46%) Gaps:40/151 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDED-----SQMRLRLKRK- 264
            |.|..|.|......:|:...:   |.|.|.|.|      ||..||.|..     ||.:.|.||: 
 Frog    65 TQPGLLLGDPPGPRIQQTGQE---EGSRTCSSD------SEDVSSSDRKLPKSLSQSKKRKKRRH 120

  Fly   265 -------------------------LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGL 304
                                     ::..||.|::.|::.|||.|...|||||:|||.||.|..|
 Frog   121 RYPNIMFEGNRPKIKFGVFTGNKGAIRSFRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTEL 185

  Fly   305 PEARIQVWFSNRRAKWRREEK 325
            ||.||||||.|||||||:.||
 Frog   186 PEDRIQVWFQNRRAKWRKREK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 42/104 (40%)
Homeodomain 267..322 CDD:459649 34/54 (63%)
vsx2XP_004917101.1 Homeodomain 147..203 CDD:459649 34/55 (62%)
OAR 318..336 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.