DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and mxtx1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_571635.2 Gene:mxtx1 / 100149566 ZFINID:ZDB-GENE-000710-7 Length:309 Species:Danio rerio


Alignment Length:350 Identity:85/350 - (24%)
Similarity:129/350 - (36%) Gaps:92/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKI 302
            |||.|..::.:.||   :..|...:||    |||||.|.::.|...||...||.:..||.|:...
Zfish     4 DSTIDATAKTSGSG---AVSRSASRRK----RTSFSKEHVELLRATFETDPYPGISLRESLSQTT 61

  Fly   303 GLPEARIQVWFSNRRAK-----------WRRE---------EKMRTQRRSADTVDGSGRTSTANN 347
            ||||:||||||.||||:           |:.:         ..|:..|::.::   ||.|     
Zfish    62 GLPESRIQVWFQNRRARTLKCKGGKKPLWQTDLPAYNNMQTSPMQIHRKNNES---SGAT----- 118

  Fly   348 PSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPP 412
              ||..|...|..:.....:...|:...:..||..:|:.....:  |:.....|..:| .|.||.
Zfish   119 --GTLCSPPPAYPDRIKEEMEKDAVCGCDTPSSMSISDDSGYCT--PSYHQSRAIQSH-MSPSPL 178

  Fly   413 LQPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYV 477
            |.|.                     ..|..|:....|..:|..               |:.||| 
Zfish   179 LSPE---------------------HQMPPNWGVRYGRRSPMS---------------SMWSPY- 206

  Fly   478 SAHHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRL 542
              |....||||...:....:|......:|: :.::|...||:.....:...:|         ||.
Zfish   207 --HLEAYACNPGFFYSHSEKHNTLQPLTPV-TPDSGCWEAGLDRTSPVDNPDV---------PRT 259

  Fly   543 Q---XSSIFGSPLDHLSKATAAAII 564
            :    |.:...||..|...:...|:
Zfish   260 EGQLESGVHHGPLPELPTLSLQEIL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 41/134 (31%)
Homeobox 269..322 CDD:395001 29/63 (46%)
mxtx1NP_571635.2 HOX 24..78 CDD:197696 29/57 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.