DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PlexA and plxnb2a.3

DIOPT Version :9

Sequence 1:NP_524637.2 Gene:PlexA / 43832 FlyBaseID:FBgn0025741 Length:1945 Species:Drosophila melanogaster
Sequence 2:XP_005164765.1 Gene:plxnb2a.3 / 561237 ZFINID:ZDB-GENE-041210-121 Length:600 Species:Danio rerio


Alignment Length:528 Identity:163/528 - (30%)
Similarity:260/528 - (49%) Gaps:60/528 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECSILDCPLNAV---RSPTD 134
            |.:|:::.|..|||:::|.||.::||:.:|:......|||:.|:.:|:   .|:.|.   ....|
Zfish    63 TIINNVVQDPQTGRIYLGAVNGIFQLNHNLQEESRADTGPKKDNPQCT---PPITAKCTDAKEMD 124

  Fly   135 NYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVS----IIEHEVPDAVVANDANSSTVAFIAPG 195
            |:||:||::.|...||.|||||:|.|::.||.:|:    ..:.:.....||:...|.||..:. .
Zfish   125 NFNKLLLVNSANGTLIVCGSLFRGICSLVNLNSVNKPVYYSDTKGEKTWVASTEESVTVVGVI-S 188

  Fly   196 PPQHPVTN----VMYVGVTYTNNSPYRSEIPAVASRSLE---KTKMFQIASSAVTTGTRTFINSY 253
            ..:...||    |..||..|.::...:    .:::|.|:   :..:|:....|.|..|.:|::.|
Zfish   189 YFKDTTTNANLSVFLVGKGYGSSDSSK----LISTRLLQEHGEMDVFENMVEASTVQTSSFVHRY 249

  Fly   254 ARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQEDSNYYSYTEIPVEC-ISD 317
            ..:     :.|.|....:.|||   ...|..:|....||.:.|:|:.|.:||||||:.:.| ::.
Zfish   250 LHD-----FRYTFKDNGYIYFL---FSRSPGTSDSRRITFIARLCENDHHYYSYTELQLNCTVNT 306

  Fly   318 AQGGTKFNLVQAGFLGKPSSDLAQSLGIS-IQDDVLFAVFSKGEGNTPTNNSALCIYSLKSIRRK 381
            .|....||.|||.:|.||...|||::..| :.|.|||.|||..|.:   ..||||:|.|.||..:
Zfish   307 EQQENTFNKVQAAYLAKPGKVLAQNIVPSNLNDKVLFGVFSADEAD---GRSALCMYPLSSINAR 368

  Fly   382 FMQNIKSCFNGSGMRG-------LDFISPSMPCVLTK--LQTIGEDFCGLD-VNSPLGG--ETPI 434
            |.:.|:||:.|..:..       ..:.|.:.....||  ...:....||.: :.|||..  |..:
Zfish   369 FEEVIESCYTGEVLEDDKPKTVYSPYNSKNEAICRTKRDKNMVKAYICGAEFLPSPLASKPEYAL 433

  Fly   435 TSVPVAMFNTKLTSVAATSTSGYTVVFVGTSDGFLKKVVIES------SSIANEYASFAVDLGSE 493
            ...|:...|..||:||....:.:||.|:|||...:.||.::.      :.|..|:...||     
Zfish   434 AVKPIYTGNDMLTAVAVAVENEHTVAFLGTSGADVLKVHLDPNHTDFYNRIPEEHTEGAV----- 493

  Fly   494 INRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYCGWCSLENKCSPRSNCQDD 558
             |:::.||....::|:.:..|:|||.|..|.....|..||..||||||||..|.:|:.:.||...
Zfish   494 -NKNLLFDTGLDHLYITTGRKISKVPVQVCGQKNDCRSCLVQRDPYCGWCVREGRCTRKKNCHKG 557

  Fly   559 ANDPLY-W 565
            ..:.:: |
Zfish   558 EGENVWLW 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlexANP_524637.2 Sema_plexin_like 75..520 CDD:200497 144/478 (30%)
PSI 522..574 CDD:279745 17/45 (38%)
PSI 671..>699 CDD:279745
PSI 830..883 CDD:279745
IPT_plexin_repeat1 885..977 CDD:238585
IPT_plexin_repeat2 978..1063 CDD:238584
IPT 1078..1177 CDD:301692
IPT_PCSR 1196..>1255 CDD:238337
Plexin_cytopl 1353..1916 CDD:285529
plxnb2a.3XP_005164765.1 Sema 58..520 CDD:301699 145/481 (30%)
PSI 522..565 CDD:279745 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100269
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.