DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PlexA and plxna3

DIOPT Version :9

Sequence 1:NP_524637.2 Gene:PlexA / 43832 FlyBaseID:FBgn0025741 Length:1945 Species:Drosophila melanogaster
Sequence 2:NP_001006866.1 Gene:plxna3 / 448633 XenbaseID:XB-GENE-856557 Length:429 Species:Xenopus tropicalis


Alignment Length:408 Identity:131/408 - (32%)
Similarity:195/408 - (47%) Gaps:79/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 STITNVAAFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECSILDCPLN 127
            |.....|..||.|.||.|...||.|::|.|||:::||.:|....:..|||..|:..|    .|..
 Frog    21 SVFPTFAVSDTSLTHLAVHKHTGDVYLGAVNRIFKLSENLTELRSHLTGPIADNSSC----YPPP 81

  Fly   128 AVR------SPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSII-------EHEV---- 175
            :||      |||||.|::||||....|::||||::||.|....|.::..:       ||.:    
 Frog    82 SVRVCTHKLSPTDNVNRLLLIDYTGKRVVACGSVWQGICQFLRLDDLFKLGEPHHRKEHYLSGAR 146

  Fly   176 -PDA----VVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSL----EK 231
             ||:    :|..|...|.                :::|.:....|.|   .|.::||.|    |.
 Frog   147 EPDSMAGVIVDQDVEQSK----------------LFIGTSIDGKSEY---FPTLSSRRLVQDEES 192

  Fly   232 TKMFQI------ASSAVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSH----HSS 286
            .:||::      .||.:...:.|.   ....::.:.|||||.|:.|.||||.||....    .:.
 Frog   193 AEMFRLVYQDEFVSSQIKVPSDTL---SLHPSFDIYYVYGFVSKIFVYFLTLQLDTQQTLLDATG 254

  Fly   287 PKEYITKLVRICQEDSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDV 351
            .|.:.:|:||:|..|..:|||.|.|:.|..|   |.::.|:|:.:|.:|...|||:|||...::|
 Frog   255 EKFFTSKIVRMCSGDLEFYSYVEFPIGCTKD---GVEYRLIQSAYLSRPGRKLAQALGIPEDEEV 316

  Fly   352 LFAVFSKGEGN--TPTNNSALCIYSLKSIRRKFMQNIKSCFNGSGMRGLDFISPSMPCVLTKLQT 414
            ||.|||:|:.|  .|...|.||:::|..|.......|:||::|.|       ..|:|.:|.|   
 Frog   317 LFTVFSQGQKNRSNPPRESVLCLFTLSQINLHIKMRIQSCYHGEG-------KLSLPWLLNK--- 371

  Fly   415 IGEDFCGLDVNSPLGGET 432
              |.||...|:..:|..|
 Frog   372 --ELFCISTVSGCIGAFT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlexANP_524637.2 Sema_plexin_like 75..520 CDD:200497 127/396 (32%)
PSI 522..574 CDD:279745
PSI 671..>699 CDD:279745
PSI 830..883 CDD:279745
IPT_plexin_repeat1 885..977 CDD:238585
IPT_plexin_repeat2 978..1063 CDD:238584
IPT 1078..1177 CDD:301692
IPT_PCSR 1196..>1255 CDD:238337
Plexin_cytopl 1353..1916 CDD:285529
plxna3NP_001006866.1 Sema 22..>378 CDD:326631 127/396 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 705 1.000 Domainoid score I123
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1383 1.000 Inparanoid score I130
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000391
OrthoInspector 1 1.000 - - otm49109
Panther 1 1.100 - - O PTHR22625
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3977
SonicParanoid 1 1.000 - - X591
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.180

Return to query results.
Submit another query.