DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and YOR292C

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_014935.3 Gene:YOR292C / 854467 SGDID:S000005818 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:41/143 - (28%)
Similarity:67/143 - (46%) Gaps:18/143 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLE---SRVPKTYSPMRRGVTKMLVDQTLFA 90
            |...:.|.:..|..:.:|.....|..|    ||.||.   :..|.......|    :|.||.|::
Yeast   173 FKTDTFDFFRWGCFMFWGFFISFFQAP----WYKFLNFFYTEDPTVVQVFER----VLSDQLLYS 229

  Fly    91 P----PFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLYA 151
            |    .|.|..::::   .|...|.:.::|...|:|.|..||::||..|.:||..:|..:|..::
Yeast   230 PISLYCFFMFSNYVM---EGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFS 291

  Fly   152 QFIALVWNCYLSM 164
            ..:.:||||:|||
Yeast   292 SSVGVVWNCFLSM 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 22/59 (37%)
YOR292CNP_014935.3 Mpv17_PMP22 243..303 CDD:397992 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2843
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.