DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT1G52870

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_564615.3 Gene:AT1G52870 / 841720 AraportID:AT1G52870 Length:366 Species:Arabidopsis thaliana


Alignment Length:158 Identity:45/158 - (28%)
Similarity:74/158 - (46%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPMRRGVTK 81
            |..:||.|:| .::.|.|.|.|..||||.|:||....|.....:|.|.|...|  :........|
plant   192 VYSVGDWIAQ-CYEGKPLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFP--FQDWWVVPVK 253

  Fly    82 MLVDQTLFAP-----PFTMA--MSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNF 139
            :..|||:::.     .||:.  :.|..|:|       |.:.:..::|.:|...:.|||.|.::.:
plant   254 VAFDQTVWSAIWNSIYFTVLGFLRFESPIS-------IFKELKATFLPMLTAGWKLWPFAHLITY 311

  Fly   140 RFVPLGYQVLYAQFIALVWNCYLSMILN 167
            ..||:..::|:...:.|:|...||...|
plant   312 GLVPVEQRLLWVDCVELIWVTILSTYSN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 14/60 (23%)
AT1G52870NP_564615.3 Mpv17_PMP22 274..335 CDD:397992 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.