DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT5G43140

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_568621.1 Gene:AT5G43140 / 834331 AraportID:AT5G43140 Length:254 Species:Arabidopsis thaliana


Alignment Length:174 Identity:47/174 - (27%)
Similarity:78/174 - (44%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLKA--YLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHF 63
            :::|::  ::...|..:.:....|..|| ....:....:|..||.|....||:|:||:...|:.:
plant    83 LRKLESHPFMTKSITTSVIYMAADLTSQ-MITMEPTGSFDLIRTARMASFGLIFLGPSQHLWFSY 146

  Fly    64 LESRVPKTYSPMRRGV----TKMLVDQTLFAP-PFTMAMSFLVPLSNGEPIDRIRQRILDSYLSI 123
            |...:||      |.|    .|:::.|.||.| ..|:..|:...| .||..:.|..|:....|..
plant   147 LSKILPK------RDVLTTFKKIMMGQVLFGPVSNTVFYSYNAAL-QGENSEEIVARLKRDLLPT 204

  Fly   124 LVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMILN 167
            |....|.||....:.|::||:..|.|.....|.:|..||:.:.|
plant   205 LKNGLMYWPVCDFVTFKYVPVHLQPLMNSSCAYIWTIYLTYMAN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 18/60 (30%)
AT5G43140NP_568621.1 Mpv17_PMP22 185..248 CDD:282035 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.