DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT5G19750

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_197476.1 Gene:AT5G19750 / 832095 AraportID:AT5G19750 Length:288 Species:Arabidopsis thaliana


Alignment Length:156 Identity:58/156 - (37%)
Similarity:79/156 - (50%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTY 72
            |...:..|.:..:||.|.|...:|.|  ..|..|||.|..:||..|||||..||.:|...|  |.
plant   128 LTKAVTAALLNLVGDLICQLTINKTS--SLDKKRTLTFTFLGLGLVGPTLHFWYLYLSKVV--TA 188

  Fly    73 SPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQML 137
            |.:...|.::|:||.:|||.|.......|....|:| ..:..::...:...::.|:.||...|.|
plant   189 SGLSGAVIRLLLDQFVFAPIFVGVFLSAVVTLEGKP-SNVIPKLQQEWTGAMIANWQLWIPFQFL 252

  Fly   138 NFRFVPLGYQVLYAQFIALVWNCYLS 163
            ||||||..||||.:..:||.||..||
plant   253 NFRFVPQNYQVLASNVVALAWNVILS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 23/58 (40%)
AT5G19750NP_197476.1 LbR-like <21..>69 CDD:248061
Mpv17_PMP22 220..278 CDD:367825 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4396
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2239
OMA 1 1.010 - - QHG55228
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 1 1.000 - - otm3570
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.