DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT4G33905

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_567940.1 Gene:AT4G33905 / 829534 AraportID:AT4G33905 Length:261 Species:Arabidopsis thaliana


Alignment Length:166 Identity:45/166 - (27%)
Similarity:74/166 - (44%) Gaps:9/166 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLE 65
            |.:.:..|...:..:.:....|..|| ...:.|:|.:|..||.|.|..||:.:||||..|::.:.
plant    89 MVKSRPVLTKSVTSSLIYIAADLSSQ-TIPQASVDSYDLVRTARMGGYGLLILGPTLHYWFNLMS 152

  Fly    66 SRVPKTYSPMRRGVT---KMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRN 127
            |..||     |..:|   ||.:.||::.|...:....|.....||....|..|:....|..::..
plant   153 SLFPK-----RDLITTFKKMAMGQTVYGPAMNVVFFSLNAALQGENGSEIVARLKRDLLPTMLNG 212

  Fly   128 YMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLS 163
            .|.||....:.|:|.|:..|.|.:...:.:|..|::
plant   213 VMYWPLCDFITFKFCPVYLQPLVSNSFSYLWTIYIT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 15/58 (26%)
AT4G33905NP_567940.1 Mpv17_PMP22 187..247 CDD:397992 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.