DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT3G24570

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_189100.1 Gene:AT3G24570 / 822053 AraportID:AT3G24570 Length:235 Species:Arabidopsis thaliana


Alignment Length:124 Identity:35/124 - (28%)
Similarity:56/124 - (45%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GLVFVGPTLRRWYHFLES-------RVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNG 106
            |..||||....||..|:.       .|||:   .|....|:.:|..:|.|...:.....:..:.|
plant    87 GFGFVGPVGHFWYEGLDKFIKLKLRYVPKS---TRFVAAKVAMDGLIFGPVDLLVFFTYMGFATG 148

  Fly   107 EPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMI 165
            :....:::.:...:|..|......||..|:.|||:||:.||:||.....||.:.:||.:
plant   149 KNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQLLYVNIFCLVDSAFLSWV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 19/60 (32%)
AT3G24570NP_189100.1 Mpv17_PMP22 144..205 CDD:397992 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.