DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT2G14860

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:142 Identity:44/142 - (30%)
Similarity:63/142 - (44%) Gaps:12/142 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPK-----TYSPMRRGVTKMLVDQTLFA 90
            |.|.:.:|..||.|.|..||..:||||..|::|:....||     |:.       ||.:.||::.
plant   109 KTSSESYDLVRTARMGGYGLFVLGPTLHYWFNFMSRLFPKQDLITTFK-------KMAMGQTIYG 166

  Fly    91 PPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIA 155
            |..|:....|.....||....|..|:....|..|....|.||....:.|||.|:..|.|.:...:
plant   167 PIMTVIFFSLNASLQGERGSVILARLKRDLLPALFNGVMYWPLCDFITFRFFPVHLQPLVSNSFS 231

  Fly   156 LVWNCYLSMILN 167
            .||..|::.:.|
plant   232 YVWTIYMTYMAN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 18/60 (30%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3570
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.