DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and PXMP2

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_061133.1 Gene:PXMP2 / 5827 HGNCID:9716 Length:195 Species:Homo sapiens


Alignment Length:166 Identity:45/166 - (27%)
Similarity:78/166 - (46%) Gaps:5/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLKAYLKDGINVAAVMCLGDTISQFFFDKKSLD---EWDAGRTLRFGIVGLVFVGPTLRRWYHFL 64
            ||...|........:..||:.::|....|:..:   ..|.|..||:.:.|..|.||....:|.|:
Human    30 RLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFM 94

  Fly    65 ESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYM 129
            |..:|... |: .|:.::|:|:.:|||.|.|....::....|:.......::...:...|..|:.
Human    95 EHWIPPEV-PL-AGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWR 157

  Fly   130 LWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMI 165
            :|...|.:|..:|||.::||:|...||.|..||:.:
Human   158 VWTPLQFININYVPLKFRVLFANLAALFWYAYLASL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 17/60 (28%)
PXMP2NP_061133.1 Mpv17_PMP22 131..193 CDD:282035 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.