DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and mpv17l2

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001002567.1 Gene:mpv17l2 / 436840 ZFINID:ZDB-GENE-040718-306 Length:199 Species:Danio rerio


Alignment Length:164 Identity:47/164 - (28%)
Similarity:77/164 - (46%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVF-----VGPTLRRWYHFLESRVPKT 71
            ::...::..||.|.|....:::     .|||..:...|.:|     :||.:..||.:|:...   
Zfish    32 VSCGGMLAAGDLIQQTREIRRT-----PGRTRDWSRTGCMFAVGCSMGPFMHYWYQWLDKYF--- 88

  Fly    72 YSPMRRGVT----KMLVDQTLFAPPFTMAMSFL-VPLSNGEPIDRIRQRILDSYLSILVRNYMLW 131
               :..|:.    |:|||| |.|.|...|..|| :.:..|......:|...|.:......::.:|
Zfish    89 ---IGNGINNVCKKVLVDQ-LVASPTLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYKADWCVW 149

  Fly   132 PAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMI 165
            |||||:||.|:|..::|||...:.|.|:.|||.:
Zfish   150 PAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 21/60 (35%)
mpv17l2NP_001002567.1 Mpv17_PMP22 121..185 CDD:282035 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.