DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and mpv17

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_957459.2 Gene:mpv17 / 394140 ZFINID:ZDB-GENE-040426-1168 Length:177 Species:Danio rerio


Alignment Length:156 Identity:55/156 - (35%)
Similarity:81/156 - (51%) Gaps:2/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPMR 76
            |...:::.:||.|||...:::.|...:|.||.:...:|..||||.:..||..|:..|  |.....
Zfish    22 ITAGSLVGVGDVISQQLIERRGLANHNARRTAKMMSIGFFFVGPVVGGWYKVLDKLV--TGGTKS 84

  Fly    77 RGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRF 141
            ..:.||||||..|||.|..|...:....||..::....::...|...|:.||.|||..|:.||.|
Zfish    85 AALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEENVAKLQRDYTDALISNYYLWPPVQIANFYF 149

  Fly   142 VPLGYQVLYAQFIALVWNCYLSMILN 167
            :||.:::...|.:|:|||.|||...|
Zfish   150 IPLHHRLAVVQIVAVVWNSYLSWKAN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 22/60 (37%)
mpv17NP_957459.2 Mpv17_PMP22 112..175 CDD:282035 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596229
Domainoid 1 1.000 56 1.000 Domainoid score I11025
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4979
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 1 1.000 - - oto38799
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X3444
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.