DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and CG32262

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_647831.1 Gene:CG32262 / 38445 FlyBaseID:FBgn0052262 Length:273 Species:Drosophila melanogaster


Alignment Length:150 Identity:37/150 - (24%)
Similarity:74/150 - (49%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VMCLGDTISQFFFDKKSL---DEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPMRRG 78
            :|.:||.|:|.:..::.|   |.:|..|..|..:.| ...||.....|::::..:|.  ..::..
  Fly    88 LMVVGDVIAQEYEYRRGLRHQDRFDTDRMYRMFVAG-ALQGPLHHYVYNWMDRVMPA--RTLKNI 149

  Fly    79 VTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVP 143
            ..|:|:||.:.:|...:...:.:.....:.:|...|.::..:..:.:.::|.|||||.||||::.
  Fly   150 FKKILIDQLVMSPACIVIFFYSLCYLERQTLDATNQELISKFPYVYMLDWMTWPAAQYLNFRYLD 214

  Fly   144 LGYQVLYAQFIALVWNCYLS 163
            ..|:|.:......|:|..:|
  Fly   215 TKYRVTFVNVCTAVYNVLMS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 16/57 (28%)
CG32262NP_647831.1 Mpv17_PMP22 175..238 CDD:282035 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463138
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.