DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and CG7970

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster


Alignment Length:154 Identity:32/154 - (20%)
Similarity:64/154 - (41%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYS-PM 75
            |....:....:..||.....|:|::..   ...:|:.||:|.|..    .|:..:.|.:.:| .:
  Fly    92 ITACVLATSANVTSQRLAGAKTLNQQS---VFAYGLFGLIFGGSV----PHYFYTTVERLFSQDV 149

  Fly    76 R-RGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNF 139
            | |.....|.::.::||.:.....|.:.|..|:......:.:...|..:|..|:........|||
  Fly   150 RFRRFFLFLSERLVYAPIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLKANWQYLSVFVYLNF 214

  Fly   140 RFVPLGYQVLYAQFIALVWNCYLS 163
            .:||..::.:....|:.:|..|::
  Fly   215 AYVPPMFRSISMAIISFIWVVYIA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 12/58 (21%)
CG7970NP_001303378.1 Mpv17_PMP22 178..238 CDD:282035 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.