DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and AT4G14305

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001031637.1 Gene:AT4G14305 / 3770487 AraportID:AT4G14305 Length:185 Species:Arabidopsis thaliana


Alignment Length:129 Identity:31/129 - (24%)
Similarity:65/129 - (50%) Gaps:10/129 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPMRRGVT---KMLVDQTLFAPPFT--MAMSFL 100
            |.|...:.|..:.||    :.||....:...:...:...|   |:|::| |.:.|:.  :.||:.
plant    52 RLLLLMLYGFAYGGP----FGHFFHKLMDTIFKGKKGNSTVAKKVLLEQ-LTSSPWNNFLFMSYY 111

  Fly   101 VPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSM 164
            ..:..|.|...::.::...|.:|.:..:..||....:|:::|||.::||::.|:|..|:.:|::
plant   112 GLVVEGRPWKLVKHKLGKDYPTIQLTAWKFWPIVGWVNYQYVPLQFRVLFSSFVASCWSIFLNL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 16/59 (27%)
AT4G14305NP_001031637.1 Mpv17_PMP22 114..174 CDD:397992 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.