DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and T18D3.9

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001024916.1 Gene:T18D3.9 / 3564939 WormBaseID:WBGene00011826 Length:181 Species:Caenorhabditis elegans


Alignment Length:155 Identity:49/155 - (31%)
Similarity:78/155 - (50%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MCL-------GDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPM 75
            ||:       ||.::|:....:   |||..||.||..:...|:.|:|..|:..||.......|.:
 Worm    20 MCIAGTISGSGDCLAQYLSHNQ---EWDRWRTARFSFLSSCFMAPSLFIWFRLLEKVKGNNKSLL 81

  Fly    76 RRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFR 140
            .  |.|:.:||..|:|.|..|:.|.:.|...:..::....:.:.:.:|...:..:||..|::|..
 Worm    82 L--VKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLLKEDWFNIYATSLKVWPFVQVVNLC 144

  Fly   141 FVPLGYQVLYAQFIALVWNCYLSMI 165
            ||||.|:|:..|.:|..||||||.|
 Worm   145 FVPLNYRVILNQVVAFFWNCYLSYI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 20/60 (33%)
T18D3.9NP_001024916.1 Mpv17_PMP22 107..171 CDD:282035 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167454
Domainoid 1 1.000 49 1.000 Domainoid score I7946
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3704
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 1 1.000 - - oto18408
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X3444
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.