DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and CG1662

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster


Alignment Length:165 Identity:41/165 - (24%)
Similarity:78/165 - (47%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLKAYLKDGINVAAVMCLGDTISQFF-FDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLES 66
            |...:...||:: .:.|:||.:.|.. .....::.:::.||....|.| |.||.....||..|:.
  Fly    73 RFLLFTNVGISL-TLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISG-VTVGVICHYWYKMLDK 135

  Fly    67 RVP-KTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYML 130
            |:| :|   ||....|:::||.:.:|.:..|....:.|...:....:.:.|.:....:....:.:
  Fly   136 RMPGRT---MRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTV 197

  Fly   131 WPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMI 165
            ||.||.:||.::|..|::.|...|:|.::...|.:
  Fly   198 WPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 13/60 (22%)
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.