DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and CG14778

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster


Alignment Length:158 Identity:40/158 - (25%)
Similarity:71/158 - (44%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INVAAVMCLGDTISQFFFDKK--SLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSP 74
            |:.:.:...|..|.|....::  :.|.|   |.|||.:.|.:||.|||..|.....:..|:|  .
  Fly    24 ISYSLIWPTGSLIQQTVEGRRWGTYDWW---RVLRFSMYGGLFVAPTLYGWVKISSAMWPQT--S 83

  Fly    75 MRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDR----IRQRILDSYLSILVRNYMLWPAAQ 135
            :|.||.|..|:...:.|.......|::.|...:.:::    :.::.|.:|...|    .:||...
  Fly    84 LRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVAL----SVWPLVA 144

  Fly   136 MLNFRFVPLGYQVLYAQFIALVWNCYLS 163
            .:||..:|...:|.:....:|.|.|:|:
  Fly   145 TINFTLIPERNRVPFISACSLCWTCFLA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 13/62 (21%)
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3570
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.