DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and CG14777

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster


Alignment Length:165 Identity:44/165 - (26%)
Similarity:76/165 - (46%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESR 67
            :|....|..:..|.:...|..|.|....:| |.|:|..|.|||.:.|.::|.|||..|.....:.
  Fly    21 KLHPMAKGALTYAVMWPAGSLIQQAMEGRK-LREYDWARALRFSLFGALYVAPTLYGWVRLTSAM 84

  Fly    68 VPKTYSPMRRGVTKMLVDQTLFAP----PFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNY 128
            .|:|  .:|.|:.|.:.:|..:.|    .|.|.||.|...:..:.::..:::...:|..    ..
  Fly    85 WPQT--NLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKV----GV 143

  Fly   129 MLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLS 163
            .:||..|.:||..||...:|::....:|:|..:|:
  Fly   144 CIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 12/58 (21%)
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3570
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.