DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and CG12355

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster


Alignment Length:145 Identity:38/145 - (26%)
Similarity:65/145 - (44%) Gaps:10/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGDTISQFFFDKKSL------DEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPMRRG 78
            :|...||.|..|:.|      ::.|.....|:.::|.....|||..||.:|:...|.|...:.  
  Fly    29 VGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKWLDRAFPGTTKVII-- 91

  Fly    79 VTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVP 143
            |.|:::||.:..|  .:...|...:|..|....|...:.:.::...:|:.:.|..||.|||..|.
  Fly    92 VKKLVLDQFVLTP--YLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWLPAQALNFSLVA 154

  Fly   144 LGYQVLYAQFIALVW 158
            ..::|:|.....|:|
  Fly   155 PRFRVIYMGICGLIW 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 14/53 (26%)
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.