DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and SPAC4G9.14

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_593696.1 Gene:SPAC4G9.14 / 2543598 PomBaseID:SPAC4G9.14 Length:221 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:55/184 - (29%)
Similarity:91/184 - (49%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKAYLKDGINVAAVMCLGDTISQF--------FFDKK--SLDEW-------------DAGRTLRF 45
            |:..|..|:..|::..|.|.::|.        |.:|:  ||:::             |..||:|:
pombe    31 LQPLLTLGLLNASLTALSDLLAQALDSYKLLKFRNKRDVSLEKYGNTILLPASTSKLDVHRTIRY 95

  Fly    46 GIVGLVFVGPTLRRWYHFLESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPID 110
            ...||... |...||:..| |.|.:|.:|....|.::.:||.:|||...:.....:.::..:..:
pombe    96 AAYGLCLT-PIQFRWFVAL-SNVIQTENPFIAIVLRVALDQFIFAPLGIVFFFLFMGITECKSYE 158

  Fly   111 RIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSM 164
            |::......|...|..||:||||.|:.||.||||..||::|..:::||..|||:
pombe   159 RLKSYFRKHYWPTLKANYILWPAVQLFNFTFVPLVLQVIFANAVSMVWTAYLSL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 24/59 (41%)
SPAC4G9.14NP_593696.1 Mpv17_PMP22 151..215 CDD:282035 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3126
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1846
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 1 1.000 - - mtm9299
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X3444
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.