DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and SPAC3G6.05

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_594971.1 Gene:SPAC3G6.05 / 2543194 PomBaseID:SPAC3G6.05 Length:206 Species:Schizosaccharomyces pombe


Alignment Length:128 Identity:39/128 - (30%)
Similarity:64/128 - (50%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYSPMRRG----VTKMLVDQTLFAPPFTMAMSFLV 101
            |.|:|...|.. :.|...||...|.::.     |:.:|    |.::|:||.:|||..|......:
pombe    68 RVLQFVTFGFA-ISPFQFRWLRLLSAKF-----PIEKGAINVVKRVLLDQAVFAPFGTAFFFSWM 126

  Fly   102 PLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSM 164
            .|:.|:.......::...:...|..|||:||..|.:||..:||.||:.:|..:|:.||.:||:
pombe   127 TLAEGKGFRGAYDKLQAVFWPTLKANYMVWPFFQTVNFWLMPLQYQMPFACTVAIFWNIFLSL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 20/59 (34%)
SPAC3G6.05NP_594971.1 Mpv17_PMP22 128..192 CDD:282035 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 1 1.000 - - mtm9299
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X3444
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.