DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and LOC100497159

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_002934856.2 Gene:LOC100497159 / 100497159 -ID:- Length:213 Species:Xenopus tropicalis


Alignment Length:155 Identity:44/155 - (28%)
Similarity:76/155 - (49%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INVAAVMCLGDTISQFF---FDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPKTYS 73
            ::...::..||.|.|.:   .:|:...:|  .||.|...:|.. :||....||.||:..:|.  :
 Frog    31 VSAGVLLSTGDAIQQTWEMRRNKEKKRDW--LRTGRMFAIGCC-LGPVDHYWYVFLDRILPG--A 90

  Fly    74 PMRRGVTKMLVDQTLFAPPFTMAMSFL-VPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQML 137
            .:|..:.|:||:| :.|.|....|.|: ..|..|..::.........:..:....:.:||.||::
 Frog    91 TVRVVLKKVLVEQ-IVASPILGTMFFMGTGLMEGHSVEESWVEFKGKFWEMYKVEWCVWPPAQII 154

  Fly   138 NFRFVPLGYQVLYAQFIALVWNCYL 162
            ||.|:|..|:|:|..|:.|.|:.||
 Frog   155 NFYFLPTKYRVMYVNFVTLAWDIYL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 17/57 (30%)
LOC100497159XP_002934856.2 Mpv17_PMP22 119..180 CDD:367825 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.