DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11077 and mpv17

DIOPT Version :9

Sequence 1:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001096523.1 Gene:mpv17 / 100125162 XenbaseID:XB-GENE-6454608 Length:177 Species:Xenopus tropicalis


Alignment Length:159 Identity:55/159 - (34%)
Similarity:84/159 - (52%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVP---KTYS 73
            :...::|.:||.|||...::|.|......||::...:|..||||.:..||..|:..||   ||.:
 Frog    22 LTAGSLMGVGDVISQQLVERKGLKGHSIERTVKMMGIGFCFVGPVVGGWYKILDRIVPGSSKTVA 86

  Fly    74 PMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLN 138
                 :.|||:||..|||.|......:....||...::|..::...|...|:.||.:|||.|:.|
 Frog    87 -----LKKMLLDQGAFAPCFLGCFLSIAGALNGLSGEQIWGKLKRDYTDALITNYYIWPAVQVAN 146

  Fly   139 FRFVPLGYQVLYAQFIALVWNCYLSMILN 167
            |.|:||.:::...|.:|::||.|||...|
 Frog   147 FYFIPLYHRLAVVQCVAVIWNSYLSWKAN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 22/60 (37%)
mpv17NP_001096523.1 Mpv17_PMP22 110..171 CDD:397992 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002366
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3444
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.