DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbeta and lid

DIOPT Version :9

Sequence 1:NP_001259081.1 Gene:ATPsynbeta / 43829 FlyBaseID:FBgn0010217 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster


Alignment Length:198 Identity:50/198 - (25%)
Similarity:76/198 - (38%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 KTVLIMELINNVAK--AHGGYSVFAGVGERTREGNDLY--NEMI--EGGV-ISLKDKTSKVALVY 252
            ||.:.:..::.:||  ...|.|:...:.|  |:..|||  :.::  |||: .:.||:  |.|.|.
  Fly   225 KTRVKLNFLDQIAKFWELQGSSLKIPMVE--RKALDLYTLHRIVQEEGGMEQTTKDR--KWAKVA 285

  Fly   253 GQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIP--SAVGYQ 315
            .:|..|........|.    |.|.|          |.:.|....:|.    :||..|  |..|..
  Fly   286 NRMQYPSSKSVGATLK----AHYER----------ILHPFEVYTSGK----VLGPTPTSSGSGST 332

  Fly   316 PTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPA 380
            |....|.|.     |..|...|.:.|.|..|.:  |:...:..|.:.:|:..||      |:.|.
  Fly   333 PVKLEDGGG-----TDYKAHEIPTRQQIAPPNE--TNTRRSKRFGNSNASCGLS------GVTPT 384

  Fly   381 VDP 383
            ..|
  Fly   385 TKP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaNP_001259081.1 PRK09280 44..507 CDD:236447 50/198 (25%)
ATP-synt_ab_N 46..112 CDD:280947
F1-ATPase_beta 114..393 CDD:238553 50/198 (25%)
ATP-synt_ab_C 401..508 CDD:278722
lidNP_001245908.1 JmjN 160..201 CDD:128818
ARID 227..312 CDD:198082 24/102 (24%)
PHD1_Lid_like 450..495 CDD:277078
JmjC 624..740 CDD:202224
zf-C5HC2 830..882 CDD:280996
PLU-1 896..1229 CDD:285609
PHD2_KDM5A 1295..1351 CDD:277079
PHD3_KDM5A_like 1755..1805 CDD:277083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.