Sequence 1: | NP_001259081.1 | Gene: | ATPsynbeta / 43829 | FlyBaseID: | FBgn0010217 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245908.1 | Gene: | lid / 33837 | FlyBaseID: | FBgn0031759 | Length: | 1838 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 50/198 - (25%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 44/198 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 KTVLIMELINNVAK--AHGGYSVFAGVGERTREGNDLY--NEMI--EGGV-ISLKDKTSKVALVY 252
Fly 253 GQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIP--SAVGYQ 315
Fly 316 PTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPA 380
Fly 381 VDP 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ATPsynbeta | NP_001259081.1 | PRK09280 | 44..507 | CDD:236447 | 50/198 (25%) |
ATP-synt_ab_N | 46..112 | CDD:280947 | |||
F1-ATPase_beta | 114..393 | CDD:238553 | 50/198 (25%) | ||
ATP-synt_ab_C | 401..508 | CDD:278722 | |||
lid | NP_001245908.1 | JmjN | 160..201 | CDD:128818 | |
ARID | 227..312 | CDD:198082 | 24/102 (24%) | ||
PHD1_Lid_like | 450..495 | CDD:277078 | |||
JmjC | 624..740 | CDD:202224 | |||
zf-C5HC2 | 830..882 | CDD:280996 | |||
PLU-1 | 896..1229 | CDD:285609 | |||
PHD2_KDM5A | 1295..1351 | CDD:277079 | |||
PHD3_KDM5A_like | 1755..1805 | CDD:277083 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0055 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |