DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbeta and KDM6B

DIOPT Version :9

Sequence 1:NP_001259081.1 Gene:ATPsynbeta / 43829 FlyBaseID:FBgn0010217 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001073893.1 Gene:KDM6B / 23135 HGNCID:29012 Length:1682 Species:Homo sapiens


Alignment Length:177 Identity:37/177 - (20%)
Similarity:54/177 - (30%) Gaps:47/177 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 GVGERTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQ 282
            ||||....|..|:    :.....|:|          |..||  |..::...||.           
Human   659 GVGELPARGPRLF----DFPPTPLED----------QFEEP--AEFKILPDGLA----------- 696

  Fly   283 DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPA 347
            :::..:|...|..:...:..|       .|..||.|.....|:|....|.             .|
Human   697 NIMKMLDESIRKEEEQQQHEA-------GVAPQPPLKEPFASLQSPFPTD-------------TA 741

  Fly   348 DDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPN 394
            ...|.||.|.|......||..:....|....||:.|....::...|:
Human   742 PTTTAPAVAVTTTTTTTTTTTATQEEEKKPPPALPPPPPLAKFPPPS 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaNP_001259081.1 PRK09280 44..507 CDD:236447 37/177 (21%)
ATP-synt_ab_N 46..112 CDD:280947
F1-ATPase_beta 114..393 CDD:238553 36/174 (21%)
ATP-synt_ab_C 401..508 CDD:278722
KDM6BNP_001073893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..88
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..680 7/24 (29%)
Mito_fiss_reg <566..640 CDD:283069
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..807 22/105 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..1096
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1325
JmjC 1343..1407 CDD:214721
JmjC 1377..1485 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.