Sequence 1: | NP_001259081.1 | Gene: | ATPsynbeta / 43829 | FlyBaseID: | FBgn0010217 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017174175.1 | Gene: | Uty / 22290 | MGIID: | 894810 | Length: | 1236 | Species: | Mus musculus |
Alignment Length: | 334 | Identity: | 57/334 - (17%) |
---|---|---|---|
Similarity: | 117/334 - (35%) | Gaps: | 100/334 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 223 TREGNDLYNEMIEGGVISLKDK-TSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLL 286
Fly 287 FIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQ-AIYVPADDL 350
Fly 351 TDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPN-----IIGQEHYNV------- 403
Fly 404 --ARGVQKILQD-----YKSLQDIIAI---LGMDELSE----------------------EDKL- 435
Fly 436 ----TVARARK-------IQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSAILAGDYDHLPEVA 489
Fly 490 FYMVGPIEE 498 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ATPsynbeta | NP_001259081.1 | PRK09280 | 44..507 | CDD:236447 | 57/334 (17%) |
ATP-synt_ab_N | 46..112 | CDD:280947 | |||
F1-ATPase_beta | 114..393 | CDD:238553 | 28/171 (16%) | ||
ATP-synt_ab_C | 401..508 | CDD:278722 | 25/149 (17%) | ||
Uty | XP_017174175.1 | TPR repeat | 88..116 | CDD:276809 | |
TPR repeat | 121..178 | CDD:276809 | |||
TPR | 130..397 | CDD:223533 | |||
TPR repeat | 183..213 | CDD:276809 | |||
TPR repeat | 224..252 | CDD:276809 | |||
TPR repeat | 262..297 | CDD:276809 | |||
TPR repeat | 304..331 | CDD:276809 | |||
TPR repeat | 336..366 | CDD:276809 | |||
TPR repeat | 371..399 | CDD:276809 | |||
JmjC | 935..999 | CDD:214721 | |||
JmjC | 969..1077 | CDD:334913 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0055 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |