DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbeta and Uty

DIOPT Version :9

Sequence 1:NP_001259081.1 Gene:ATPsynbeta / 43829 FlyBaseID:FBgn0010217 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_017174175.1 Gene:Uty / 22290 MGIID:894810 Length:1236 Species:Mus musculus


Alignment Length:334 Identity:57/334 - (17%)
Similarity:117/334 - (35%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 TREGNDLYNEMIEGGVISLKDK-TSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLL 286
            |:|..|..::.:.... |.||: ||.:.     :|....:.....::.:.::.....:.....|:
Mouse   555 TKESKDSRSKSLTSKT-SRKDRDTSNIC-----VNAKKHSNHIYQISSVPISSLNNKESVSPDLI 613

  Fly   287 FIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQ-AIYVPADDL 350
            .:||        .::|.|:|.....|.:      |:|:..:         :.:|. ||:...|:|
Mouse   614 IVDN--------PQLSVLVGETIDNVDH------DIGTCDK---------VNNVHLAIHKKPDNL 655

  Fly   351 TDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPN-----IIGQEHYNV------- 403
            :..:|::..    :|..||..:.|        .....:..:.|:     |.|:.|.|:       
Mouse   656 SASSPSSAI----STETLSLKLTE--------QTHIVTSFISPHSGLHTINGEGHENLESSASVN 708

  Fly   404 --ARGVQKILQD-----YKSLQDIIAI---LGMDELSE----------------------EDKL- 435
              .|...:|:..     |.|..:::..   ||.:.||.                      ::|| 
Mouse   709 VGLRPRSQIIPSMSVSIYSSSTEVLKACRSLGKNGLSNGHILLDICPPPRPPTSPYPPLPKEKLN 773

  Fly   436 ----TVARARK-------IQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSAILAGDYDHLPEVA 489
                ::....|       :.:|...|.....|..|.||.| .|:..:.....::..:.:|:.||.
Mouse   774 PPTPSIYLENKRDAFFPPLHQFCINPKNPVTVIRGLAGAL-KLDLGLFSTKTLVEANNEHIVEVR 837

  Fly   490 FYMVGPIEE 498
            ..::.|.:|
Mouse   838 TQLLQPADE 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaNP_001259081.1 PRK09280 44..507 CDD:236447 57/334 (17%)
ATP-synt_ab_N 46..112 CDD:280947
F1-ATPase_beta 114..393 CDD:238553 28/171 (16%)
ATP-synt_ab_C 401..508 CDD:278722 25/149 (17%)
UtyXP_017174175.1 TPR repeat 88..116 CDD:276809
TPR repeat 121..178 CDD:276809
TPR 130..397 CDD:223533
TPR repeat 183..213 CDD:276809
TPR repeat 224..252 CDD:276809
TPR repeat 262..297 CDD:276809
TPR repeat 304..331 CDD:276809
TPR repeat 336..366 CDD:276809
TPR repeat 371..399 CDD:276809
JmjC 935..999 CDD:214721
JmjC 969..1077 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.