Sequence 1: | NP_001259081.1 | Gene: | ATPsynbeta / 43829 | FlyBaseID: | FBgn0010217 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510405.1 | Gene: | jmjd-3.2 / 181543 | WormBaseID: | WBGene00009089 | Length: | 867 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 38/199 - (19%) |
---|---|---|---|
Similarity: | 62/199 - (31%) | Gaps: | 66/199 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 TTTKKGSITSVQAIYVPADDLTD----------PAPATTFAHLDATTVLSRAIAELGIYPAVDPL 384
Fly 385 DSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDI---IAILGMDELSEEDKLTVARARKIQRF 446
Fly 447 LSQPFQVAEVFTGHAGKLVPLEQTIKGFSAILAGDYDHLPEVAFYMVGPI-----EEVVEKADRL 506
Fly 507 AKEA 510 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ATPsynbeta | NP_001259081.1 | PRK09280 | 44..507 | CDD:236447 | 36/194 (19%) |
ATP-synt_ab_N | 46..112 | CDD:280947 | |||
F1-ATPase_beta | 114..393 | CDD:238553 | 15/72 (21%) | ||
ATP-synt_ab_C | 401..508 | CDD:278722 | 19/114 (17%) | ||
jmjd-3.2 | NP_510405.1 | COG5644 | 40..>191 | CDD:227931 | 28/160 (18%) |
JmjC | 577..641 | CDD:214721 | |||
JmjC | 611..719 | CDD:334913 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0055 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |