DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ATPsynbeta and utx-1

DIOPT Version :9

Sequence 1:	NP_001259081.1	Gene:	ATPsynbeta / 43829	FlyBaseID:	FBgn0010217	Length:	511	Species:	Drosophila melanogaster
Sequence 2:	NP_001309685.1	Gene:	utx-1 / 181110	WormBaseID:	WBGene00017046	Length:	1146	Species:	Caenorhabditis elegans

Alignment Length:	66	Identity:	19/66 - (28%)
Similarity:	28/66 - (42%)	Gaps:	14/66 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 GAVVDVQFDDNL----------PPILNA--LEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLV 103
            |.|..:..|:::          |.||..  |.||||.....||:.:.|..:|:..|.  |..|.:
Worm   659 GPVKPIVTDEDVRTALERSEKHPLILKTPILTVDNRKEAQSLELQRFLDGSTISCIR--GLTGCL 721

  Fly   104 R 104
            |
Worm   722 R 722

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ATPsynbeta	NP_001259081.1	PRK09280	44..507	CDD:236447	19/66 (29%)
		ATP-synt_ab_N	46..112	CDD:280947	19/66 (29%)
		F1-ATPase_beta	114..393	CDD:238553
		ATP-synt_ab_C	401..508	CDD:278722
utx-1	NP_001309685.1	TPR_11	138..204	CDD:290150
		TPR repeat	138..168	CDD:276809
		TPR repeat	176..203	CDD:276809
		TPR repeat	271..301	CDD:276809
		TPR repeat	315..348	CDD:276809
		TPR_11	353..419	CDD:290150
		TPR repeat	353..383	CDD:276809
		TPR_1	354..387	CDD:278916
		TPR repeat	388..415	CDD:276809
		TPR	390..419	CDD:197478
		JmjC	845..909	CDD:214721
		JmjC	879..987	CDD:202224
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0055
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900