Sequence 1: | NP_001259081.1 | Gene: | ATPsynbeta / 43829 | FlyBaseID: | FBgn0010217 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497938.1 | Gene: | asb-1 / 175605 | WormBaseID: | WBGene00000206 | Length: | 301 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 41/197 - (20%) |
---|---|---|---|
Similarity: | 59/197 - (29%) | Gaps: | 81/197 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 KVVDLLAPYAKGGKIGLF--------------GGAGVGKTVLIMELINNVAKAHGGYSVFAGVGE 221
Fly 222 RTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLL 286
Fly 287 FIDNIFRFTQAGSEVS--ALLGRIPSAV----------GYQPTLATDMGSMQERITTTKKGSITS 339
Fly 340 VQ 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ATPsynbeta | NP_001259081.1 | PRK09280 | 44..507 | CDD:236447 | 41/197 (21%) |
ATP-synt_ab_N | 46..112 | CDD:280947 | |||
F1-ATPase_beta | 114..393 | CDD:238553 | 41/197 (21%) | ||
ATP-synt_ab_C | 401..508 | CDD:278722 | |||
asb-1 | NP_497938.1 | Mt_ATP-synt_B | 134..297 | CDD:283144 | 35/181 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3209 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |