DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbeta and asb-1

DIOPT Version :9

Sequence 1:NP_001259081.1 Gene:ATPsynbeta / 43829 FlyBaseID:FBgn0010217 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_497938.1 Gene:asb-1 / 175605 WormBaseID:WBGene00000206 Length:301 Species:Caenorhabditis elegans


Alignment Length:197 Identity:41/197 - (20%)
Similarity:59/197 - (29%) Gaps:81/197 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KVVDLLAPYAKGGKIGLF--------------GGAGVGKTVLIMELINNVAKAHGGYSVFAGVGE 221
            ||.....||...|  |||              |...|| .:|...|::..|    ||.:.||   
 Worm   120 KVTGTSGPYLFFG--GLFAFLVNKELWVFEEQGHMTVG-WILFYLLVSRTA----GYKIDAG--- 174

  Fly   222 RTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLL 286
                   ||           ||...:|....|.:.|                         |:..
 Worm   175 -------LY-----------KDYQERVGFFKGLIQE-------------------------DLKE 196

  Fly   287 FIDNIFRFTQAGSEVS--ALLGRIPSAV----------GYQPTLATDMGSMQERITTTKKGSITS 339
            .:|  ||.|.|....|  ||...:|:::          .|:..:.|....::.||...|:...|.
 Worm   197 AVD--FRKTSAAQTASFAALKEGMPTSLKDSMQLQLEAAYRKNVQTISNEIKRRIEYLKETEETK 259

  Fly   340 VQ 341
            .:
 Worm   260 AR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaNP_001259081.1 PRK09280 44..507 CDD:236447 41/197 (21%)
ATP-synt_ab_N 46..112 CDD:280947
F1-ATPase_beta 114..393 CDD:238553 41/197 (21%)
ATP-synt_ab_C 401..508 CDD:278722
asb-1NP_497938.1 Mt_ATP-synt_B 134..297 CDD:283144 35/181 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3209
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.