DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and PSKH2

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_016869418.1 Gene:PSKH2 / 85481 HGNCID:18997 Length:504 Species:Homo sapiens


Alignment Length:329 Identity:111/329 - (33%)
Similarity:176/329 - (53%) Gaps:36/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHD 78
            ||||..:|.|:||.|.|..||:|...||.|::.|::...|  :....|..:.|::.|..||:|.:
Human   182 YDIKALIGTGSFSRVVRVEQKTTKKPFAIKVMETREREGR--EACVSELSVLRRVSHRYIVQLME 244

  Fly    79 SIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLL 143
            ..:.|:..|:|.:|.||||||:.::|:..::|.||...:|.:.:.:.:.|...:.||:|||||||
Human   245 IFETEDQVYMVMELATGGELFDRLIAQGSFTERDAVRILQMVADGIRYLHALQITHRNLKPENLL 309

  Fly   144 LASKAKGAAVKLADFGLAI--EVQGDHQAWF--GFAGTPGYLSPEVLKKEPYGKSVDIWACGVIL 204
            .....:.:.:.:.|||||.  :..||   |.  ...|||.|::||||.::||..:||:||.|||.
Human   310 YYHPGEESKILITDFGLAYSGKKSGD---WTMKTLCGTPEYIAPEVLLRKPYTSAVDMWALGVIT 371

  Fly   205 YILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKH 269
            |.||.|:.||.||.|.|||.:|..|.|:|....|.:::..||:.|:::|.:....|::|.:||.|
Human   372 YALLSGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDH 436

  Fly   270 PWICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTD 334
            ||:......:|:.:.|..:                           ||:::.:....||...|..
Human   437 PWVITMAAGSSMKNLQRAI---------------------------SRNLMQRASPHSQSPGSAQ 474

  Fly   335 SSST 338
            ||.:
Human   475 SSKS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 104/292 (36%)
S_TKc 14..272 CDD:214567 101/261 (39%)
CaMKII_AD 390..517 CDD:285524
PSKH2XP_016869418.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.