DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and DCLK3

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001381601.1 Gene:DCLK3 / 85443 HGNCID:19005 Length:817 Species:Homo sapiens


Alignment Length:279 Identity:111/279 - (39%)
Similarity:173/279 - (62%) Gaps:8/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLH 77
            :|:....:|.|.|::||.|..:.|...:|.|||:..:|..:: ..::.|..|.:.|.|||||:||
Human   524 HYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKE-DMVDSEILIIQSLSHPNIVKLH 587

  Fly    78 DSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENL 142
            :..:.:...||:.:.|.||:||:.|:....:.|.||:..|..:.:::.|.|...:||||||||||
Human   588 EVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHRDLKPENL 652

  Fly   143 LL-ASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            |: .::.|...:||||||||..|.   :..|...|||.|::||:|.::.||..||:||.||||||
Human   653 LVQRNEDKSTTLKLADFGLAKHVV---RPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYI 714

  Fly   207 LLVGYPPFW--DEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKH 269
            ||.|:|||.  :.||..|::.|:.|.:::..|.||.::..||:|::::|.|:|.||.||.:.|:|
Human   715 LLCGFPPFRSPERDQDELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQH 779

  Fly   270 PWICQRERVASVVHRQETV 288
            ||| :.....:.|.||:.|
Human   780 PWI-ETAGKTNTVKRQKQV 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 111/279 (40%)
S_TKc 14..272 CDD:214567 105/260 (40%)
CaMKII_AD 390..517 CDD:285524
DCLK3NP_001381601.1 DCX_DCLK3 93..177 CDD:340528
STKc_DCKL3 524..781 CDD:271087 104/260 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.