DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and CAMK1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_005265573.1 Gene:CAMK1 / 8536 HGNCID:1459 Length:413 Species:Homo sapiens


Alignment Length:315 Identity:126/315 - (40%)
Similarity:186/315 - (59%) Gaps:3/315 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRL 76
            |.||.::.||.||||.|.....|.|....|.|.|..:.|..:: ..:|.|..:..|:.|||||.|
Human    18 DIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE-GSMENEIAVLHKIKHPNIVAL 81

  Fly    77 HDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPEN 141
            .|..:...:.||:..||:|||||:.||.:.||:|.|||..|.|:|::|.:.|..|:|||||||||
Human    82 DDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPEN 146

  Fly   142 LLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI 206
            ||..|..:.:.:.::||||: :::..........|||||::||||.::||.|:||.|:.|||.||
Human   147 LLYYSLDEDSKIMISDFGLS-KMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI 210

  Fly   207 LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW 271
            ||.|||||:||:..:|:.||....|::.||.||.::..||:.|..::..:|.||.|..:||:|||
Human   211 LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPW 275

  Fly   272 ICQRERVASVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMITKKGEG 326
            |.....:...:| |...:.:||..|:.|.|.|...|.:.......:...:::|:|
Human   276 IAGDTALDKNIH-QSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 122/290 (42%)
S_TKc 14..272 CDD:214567 112/257 (44%)
CaMKII_AD 390..517 CDD:285524
CAMK1XP_005265573.1 STKc_CaMKI_alpha 16..278 CDD:271069 115/261 (44%)
S_TKc 20..276 CDD:214567 112/257 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.