DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and RCK1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_011357.1 Gene:RCK1 / 852719 SGDID:S000003126 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:406 Identity:119/406 - (29%)
Similarity:191/406 - (47%) Gaps:82/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NYDIKEELGKGAFSIVKRCVQKST--------------GFEFAAKIINTKKLTARDFQKLEREAR 63
            ||.:..::|:||||.|.:.|..:|              |....|.:....::.....:|:..|..
Yeast   120 NYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKVLNEVA 184

  Fly    64 ICRKL---HHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVN 125
            | .||   ::|:..:.....:..||:|||.:||||||:|:.||....:||..|.|.|.|:..::.
Yeast   185 I-HKLVSKNNPHCTKFIAFQESANYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIK 248

  Fly   126 HCHQNGVVHRDLKPENLL--------------------LASKAKG-AAVKLADFGLAIEVQGDHQ 169
            |.|..|:||||:||||||                    |.....| ..|||.|||||.:::.:  
Yeast   249 HMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNN-- 311

  Fly   170 AWFGFAGTP----GYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGA 230
                .|.||    .|::.||...:.|...||:|:.|.:|:.||.|||||:::::..|..:|..|.
Yeast   312 ----TAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGD 372

  Fly   231 YDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFN 295
            |::.:|.||.::..|||.:..:|.|:||||....:.|..||:             .:.||||..|
Yeast   373 YEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDDFLNDPWL-------------NSYDCLKDSN 424

  Fly   296 ARRKLKGAILTTMLATRNFSSR--------SMITKKGEGSQVKESTDSSSTTLEDDD-------I 345
            :.   ..|.:.::| ..:|..|        |..::|.:.::...|..|....:.::|       |
Yeast   425 SN---SYASVQSIL-NDSFDERAETLHCALSCQSEKQDDTEFSRSESSEYIFMTEEDRNLRGSWI 485

  Fly   346 KEDKK-GTVDRSTTVV 360
            .|.|: .|:|.:|:.:
Yeast   486 GEPKECFTLDLATSSI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 104/331 (31%)
S_TKc 14..272 CDD:214567 97/299 (32%)
CaMKII_AD 390..517 CDD:285524
RCK1NP_011357.1 STKc_RCK1-like 119..414 CDD:270998 98/300 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.