DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and DUN1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_010182.1 Gene:DUN1 / 851457 SGDID:S000002259 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:110/309 - (35%)
Similarity:161/309 - (52%) Gaps:33/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQK----LEREARICRKLHH 70
            |.|.|.:.:|||.|.:::||....|.||.:.|.||.:.::   .|.||    ...|..|..::.|
Yeast   196 FFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQ---NDDQKKNKQFREETNILMRVQH 257

  Fly    71 PNIVRLHDSIQE-----ENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQN 130
            ||||.|.||..|     :...|||.:.:..|||||.||.:....:.::....:|:|..:.:.|:.
Yeast   258 PNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQ 322

  Fly   131 GVVHRDLKPENLLLASKAK----------------GAAVKLADFGLAIEVQGDHQAWFGFAGTPG 179
            .::|||:||||:||....:                ...||:|||||| :..|:.|......|||.
Yeast   323 NIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLA-KFTGEMQFTNTLCGTPS 386

  Fly   180 YLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDE-DQHRLYSQIKAGAYDYPSPEWDTVTP 243
            |::||||.|:.|...||:|:.|||||:.|.|:|||.|: ....|..||....|.:.||.||.:..
Yeast   387 YVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDD 451

  Fly   244 EAKNLINQMLTVNPNKRITAAEALKHPW---ICQRERVASVVHRQETVD 289
            ...:||:.:|.:||::|....|||.|||   |.|:..|:..:.|.:..|
Yeast   452 SVLHLISNLLVLNPDERYNIDEALNHPWFNDIQQQSSVSLELQRLQITD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 109/307 (36%)
S_TKc 14..272 CDD:214567 103/286 (36%)
CaMKII_AD 390..517 CDD:285524
DUN1NP_010182.1 FHA 36..136 CDD:238017
STKc_CAMK 199..479 CDD:270687 101/283 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.