DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and PPCK1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_172341.1 Gene:PPCK1 / 837387 AraportID:AT1G08650 Length:284 Species:Arabidopsis thaliana


Alignment Length:266 Identity:93/266 - (34%)
Similarity:158/266 - (59%) Gaps:8/266 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQK--LEREARICRKL-HHPN 72
            ::.|.|.||:|:|.|..|.|....:||..||.|.|:...| :.|..:  |:.|.::...| :|||
plant    12 TNKYQICEEIGRGRFGTVSRVYAPATGDFFACKTIDKASL-SDDLDRACLDNEPKLMALLSYHPN 75

  Fly    73 IVRLHDSIQEENYHYLVFDLV-TGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRD 136
            ||::||.|..::...:..:|| ....:::.:|:...:.|...:...:|||::::|||:.||||||
plant    76 IVQIHDLIDTDSTLSIFMELVHPSVSIYDRLVSSGTFFEPQTASFAKQILQALSHCHRYGVVHRD 140

  Fly   137 LKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACG 201
            :||||:|:  ..:...||:.|||..|.: |:.:...|..|||.|::||||....||:.||:|:.|
plant   141 IKPENILV--DLRNDTVKICDFGSGIWL-GEGETTEGVVGTPYYVAPEVLMGYSYGEKVDLWSAG 202

  Fly   202 VILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEA 266
            |:||.:|.|.|||:.|....::..:..|...:|:..:..|:..||:.:.:::..:.::|.:|.:|
plant   203 VVLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDASRRFSAEQA 267

  Fly   267 LKHPWI 272
            |:||||
plant   268 LRHPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 93/265 (35%)
S_TKc 14..272 CDD:214567 91/261 (35%)
CaMKII_AD 390..517 CDD:285524
PPCK1NP_172341.1 STKc_CAMK 14..272 CDD:270687 90/261 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.