DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and CDPK9

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_197748.1 Gene:CDPK9 / 832424 AraportID:AT5G23580 Length:490 Species:Arabidopsis thaliana


Alignment Length:385 Identity:139/385 - (36%)
Similarity:205/385 - (53%) Gaps:50/385 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTAR-DFQKLEREARICRK 67
            |.......|||.:.:.||:|.|.....|..|.||.:.|.|.|..:||..: |:..:.||.:|   
plant    12 PYKTKNVEDNYFLGQVLGQGQFGTTFLCTHKQTGQKLACKSIPKRKLLCQEDYDDVLREIQI--- 73

  Fly    68 LHH----PNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCH 128
            :||    ||:||:..:.::....:||.:|..|||||:.||.|..|||.:|:..|:.|:..|..||
plant    74 MHHLSEYPNVVRIESAYEDTKNVHLVMELCEGGELFDRIVKRGHYSEREAAKLIKTIVGVVEACH 138

  Fly   129 QNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGK 193
            ..|||||||||||.|.:|..:.|::|..||||::... ..:|:....|:..|::||||.|. ||.
plant   139 SLGVVHRDLKPENFLFSSSDEDASLKSTDFGLSVFCT-PGEAFSELVGSAYYVAPEVLHKH-YGP 201

  Fly   194 SVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPN 258
            ..|:|:.||||||||.|:||||.|.:..::.:|..|..::....|.:::..||:||.:||..||.
plant   202 ECDVWSAGVILYILLCGFPPFWAESEIGIFRKILQGKLEFEINPWPSISESAKDLIKKMLESNPK 266

  Fly   259 KRITAAEALKHPWICQRERVASVVHRQETVDC-----LKKFNARRKLKGAILTTMLATRNFSSR- 317
            ||:||.:.|.||||.. ::||.    .:.:||     ||||:|..|||      .:|.|..:.| 
plant   267 KRLTAHQVLCHPWIVD-DKVAP----DKPLDCAVVSRLKKFSAMNKLK------KMALRVIAERL 320

  Fly   318 ------------SMITKKGEGS----QVKESTDSSSTTLEDDDIKE-------DKKGTVD 354
                        .||.....|:    ::|:|.....:.|.:.:|:|       |:.||:|
plant   321 SEEEIGGLKELFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAADVDESGTID 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 123/300 (41%)
S_TKc 14..272 CDD:214567 107/262 (41%)
CaMKII_AD 390..517 CDD:285524
CDPK9NP_197748.1 STKc_CAMK 21..279 CDD:270687 107/262 (41%)
Pkinase 22..280 CDD:278497 107/262 (41%)
PTZ00184 316..458 CDD:185504 13/65 (20%)
EFh 328..387 CDD:238008 12/53 (23%)
EFh 400..459 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 227 1.000 Domainoid score I670
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.