DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and AT3G56760

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_191235.1 Gene:AT3G56760 / 824843 AraportID:AT3G56760 Length:577 Species:Arabidopsis thaliana


Alignment Length:272 Identity:100/272 - (36%)
Similarity:156/272 - (57%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RFSDNYDIKEELGKGAFSIVKRCVQKS-----TGFEFAAKII-NTKKLTARDFQKLEREARICRK 67
            :|:.:|:|..|:|:|.|...  |..|.     .|.:.|.|:| .:|..||...:.:.||.:|.|.
plant   119 QFASHYEIDGEVGRGHFGYT--CSAKGKKGSLKGQDVAVKVIPKSKMTTAIAIEDVRREVKILRA 181

  Fly    68 L-HHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAR-EFYSEADASHCIQQILESVNHCHQN 130
            | .|.|:|:.:|:.:::...|:|.:|..||||.:.|:.| ..|||.||...:.|||..|.:||..
plant   182 LTGHKNLVQFYDAFEDDENVYIVMELCQGGELLDKILQRGGKYSEVDAKKVMIQILSVVAYCHLQ 246

  Fly   131 GVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSV 195
            |||||||||||.|..:|.:.:.:|..||||:..|:.|.:. ....|:..|::||||.: .||...
plant   247 GVVHRDLKPENFLFTTKDESSPLKAIDFGLSDYVRPDERL-NDIVGSAYYVAPEVLHR-TYGTEA 309

  Fly   196 DIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKR 260
            |:|:.|||.||||.|..|||...:..::..:.....::....|.:::|:|.:.:.::|..:..||
plant   310 DMWSIGVIAYILLCGSRPFWARSESGIFRAVLKAEPNFEEAPWPSLSPDAVDFVKRLLNKDYRKR 374

  Fly   261 ITAAEALKHPWI 272
            :|||:||.|||:
plant   375 LTAAQALCHPWL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 99/269 (37%)
S_TKc 14..272 CDD:214567 98/265 (37%)
CaMKII_AD 390..517 CDD:285524
AT3G56760NP_191235.1 STKc_CAMK 123..385 CDD:270687 97/265 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 227 1.000 Domainoid score I670
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.