DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and PPCK2

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_566229.1 Gene:PPCK2 / 819609 AraportID:AT3G04530 Length:278 Species:Arabidopsis thaliana


Alignment Length:275 Identity:96/275 - (34%)
Similarity:156/275 - (56%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKL-TARDFQKLEREARICRKL-HHPNIV 74
            :||.:.:|:|:|.|..:.||...:|...:|.|.|:.:.| .|.|.:.:|.|.||...| .||||:
plant     9 NNYQLCDEIGRGRFGTITRCFSPATKEFYACKTIDKRVLIDALDRECIETEPRIMAMLPPHPNII 73

  Fly    75 RLHDSIQEENYHYLVFDLV------------TGGELFEDIVAREFYSEADASHCIQQILESVNHC 127
            |:.|..:.|:...:|.:||            .||.|          ||::::...:|||.::.||
plant    74 RIFDLYETEDSLAIVMELVDPPMTIYDRLISAGGRL----------SESESASYAKQILSALAHC 128

  Fly   128 HQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYG 192
            |:..|||||:||:|:|:...:.|  |||.|||.|:.:.|:...  |..|||.|::|||:....|.
plant   129 HRCDVVHRDVKPDNVLVDLVSGG--VKLCDFGSAVWLGGETAE--GVVGTPYYVAPEVVMGRKYD 189

  Fly   193 KSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNP 257
            :.||||:.||::|.:|.|.|||..|....::..|..|...:|..::.:|:.|||:|:.:|:..:.
plant   190 EKVDIWSAGVVIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDV 254

  Fly   258 NKRITAAEALKHPWI 272
            ::|.:|.:||:|.|:
plant   255 SRRFSAEDALRHSWM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 96/275 (35%)
S_TKc 14..272 CDD:214567 94/271 (35%)
CaMKII_AD 390..517 CDD:285524
PPCK2NP_566229.1 STKc_CAMK 10..268 CDD:270687 95/271 (35%)
S_TKc 11..269 CDD:214567 94/271 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.