DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKII and CRK1

DIOPT Version :9

Sequence 1:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_181647.1 Gene:CRK1 / 818713 AraportID:AT2G41140 Length:576 Species:Arabidopsis thaliana


Alignment Length:351 Identity:112/351 - (31%)
Similarity:181/351 - (51%) Gaps:29/351 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RFSDNYDIKEELGKGAFSIVKRCVQKS-----TGFEFAAKII-NTKKLTARDFQKLEREARICRK 67
            :|:.:|:|..|:|:|.|...  |..|.     .|.|.|.|:| .:|..||...:.:.||.::.|.
plant   118 QFASHYEIDGEVGRGHFGYT--CSAKGKKGSLKGQEVAVKVIPKSKMTTAIAIEDVSREVKMLRA 180

  Fly    68 L-HHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAR-EFYSEADASHCIQQILESVNHCHQN 130
            | .|.|:|:.:|:.:::...|:|.:|..||||.:.|:.| ..|||.||...:.|||..|.:||..
plant   181 LTGHKNLVQFYDAFEDDENVYIVMELCKGGELLDKILQRGGKYSEDDAKKVMVQILSVVAYCHLQ 245

  Fly   131 GVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSV 195
            |||||||||||.|.::|.:.:.:|..||||:..|:.|.:. ....|:..|::||||.: .||...
plant   246 GVVHRDLKPENFLFSTKDETSPLKAIDFGLSDYVKPDERL-NDIVGSAYYVAPEVLHR-TYGTEA 308

  Fly   196 DIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKR 260
            |:|:.|||.||||.|..|||...:..::..:.....::....|.:::|||.:.:.::|..:..||
plant   309 DMWSIGVIAYILLCGSRPFWARTESGIFRAVLKAEPNFEEAPWPSLSPEAVDFVKRLLNKDYRKR 373

  Fly   261 ITAAEALKHPWICQRERVA----SVVHRQETVDCLKKFNARRKLKGAILTTMLATRNFSSRSMIT 321
            :|||:||.|||:.....:.    .::::...| .:...:.|:....|:..|:...:....|...|
plant   374 LTAAQALCHPWLVGSHELKIPSDMIIYKLVKV-YIMSTSLRKSALAALAKTLTVPQLAYLREQFT 437

  Fly   322 KKGEGSQ------------VKESTDS 335
            ..|....            :|.|||:
plant   438 LLGPSKNGYISMQNYKTAILKSSTDA 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 102/302 (34%)
S_TKc 14..272 CDD:214567 99/265 (37%)
CaMKII_AD 390..517 CDD:285524
CRK1NP_181647.1 STKc_CAMK 122..384 CDD:270687 98/265 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 227 1.000 Domainoid score I670
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.